PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 514aa    MW: 57212.8 Da    PI: 7.3767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032298genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
      Lus10032298 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.54.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T++E++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
      Lus10032298  67 RGRFTPDEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466892.02E-2912108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002494.6E-151461IPR001005SANT/Myb domain
CDDcd001671.15E-111761No hitNo description
PROSITE profilePS5129425.12262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2465116IPR009057Homeodomain-like
SMARTSM007177.5E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1467111IPR001005SANT/Myb domain
CDDcd001671.56E-1169111No hitNo description
PfamPF035012.3E-42338429IPR005326Plectin/S10, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPDEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPP  120
PPYPSPPSLS SSSPLLLQST PPPPPCTGVS GATHHQLVTI TSYPTSTHVL DPSHQPEPGP  180
RGTHLFPSAV QDAVFHPPPP LPSIFIFDGD HHHHHHQNQL FIEPISGSWN DHNFHHHNHN  240
HNHPPPPQSH QPFGFLPPLF EHDGDHMVGS MEDVDQEGTA GARTVMMNDE EWAAAVDSRH  300
EPSSGNNSFL FWEENDVVVD EGGIIRCGGD SNFTAAIISE KNRREISKYL FQEGVCYAKK  360
DFNLAKHPDI DVPNLQVIKL MQSFKSKEYV GETFAWMHYY WYLTNEGIEF LRAYLNLPSE  420
IVPATLKKQA KAGGRPQFGG DRPRGPPRSD GERRFGGDRE GYRSGPRAPG GEYGDKGGAP  480
ADYRPTYGGP RAGFGRGGGS YSGGAAATSS DLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v7e_BK5e-61337487215640S ribosomal protein S10E
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054774.11e-169PREDICTED: transcription factor MYB51
TrEMBLA0A0B2NS981e-153A0A0B2NS98_GLYSO; 40S ribosomal protein S10
STRINGPOPTR_0003s13190.12e-86(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-83myb domain protein 103